![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
![]() | Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) ![]() |
![]() | Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
![]() | Protein Interleukin-2 receptor alpha chain [144117] (1 species) consists of two segment-swapped SCR domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144118] (5 PDB entries) Uniprot P01589 121-186! Uniprot P01589 124-186! Uniprot P01589 125-186! Uniprot P01589 22-85 |
![]() | Domain d2erje1: 2erj E:100-165 [132295] Other proteins in same PDB: d2erjb1, d2erjb2, d2erjb3, d2erjc1, d2erjc2, d2erjd_, d2erjf1, d2erjf2, d2erjf3, d2erjg1, d2erjg2, d2erjh_ automated match to d2erja1 complexed with nag |
PDB Entry: 2erj (more details), 3 Å
SCOPe Domain Sequences for d2erje1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2erje1 g.18.1.1 (E:100-165) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} lpghcrepppweneateriyhfvvgqmvyyqcvqgyralhrgpaesvckmthgktrwtqp qlictg
Timeline for d2erje1: