| Class g: Small proteins [56992] (90 folds) |
| Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) ![]() |
| Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins) Pfam PF00084 |
| Protein Interleukin-2 receptor alpha chain [144117] (1 species) consists of two segment-swapped SCR domains |
| Species Human (Homo sapiens) [TaxId:9606] [144118] (3 PDB entries) Uniprot P01589 121-186! Uniprot P01589 124-186! Uniprot P01589 125-186! Uniprot P01589 22-85 |
| Domain d2erje1: 2erj E:100-165 [132295] Other proteins in same PDB: d2erjb1, d2erjb2, d2erjc1, d2erjc2, d2erjd1, d2erjf1, d2erjf2, d2erjg1, d2erjg2, d2erjh1 automatically matched to 2ERJ A:100-165 complexed with bma, fuc, nag; mutant |
PDB Entry: 2erj (more details), 3 Å
SCOP Domain Sequences for d2erje1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2erje1 g.18.1.1 (E:100-165) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
lpghcrepppweneateriyhfvvgqmvyyqcvqgyralhrgpaesvckmthgktrwtqp
qlictg
Timeline for d2erje1: