Lineage for d2erjd1 (2erj D:6-133)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767022Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 767023Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 767095Family a.26.1.2: Short-chain cytokines [47286] (13 proteins)
  6. 767134Protein Interleukin-2 (IL-2) [47301] (1 species)
  7. 767135Species Human (Homo sapiens) [TaxId:9606] [47302] (14 PDB entries)
  8. 767152Domain d2erjd1: 2erj D:6-133 [132294]
    Other proteins in same PDB: d2erja1, d2erja2, d2erjb1, d2erjb2, d2erjc1, d2erjc2, d2erje1, d2erje2, d2erjf1, d2erjf2, d2erjg1, d2erjg2
    automatically matched to d3inkc_
    complexed with bma, fuc, nag; mutant

Details for d2erjd1

PDB Entry: 2erj (more details), 3 Å

PDB Description: crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2
PDB Compounds: (D:) interleukin-2

SCOP Domain Sequences for d2erjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2erjd1 a.26.1.2 (D:6-133) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp
leevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwitfa
qsiistlt

SCOP Domain Coordinates for d2erjd1:

Click to download the PDB-style file with coordinates for d2erjd1.
(The format of our PDB-style files is described here.)

Timeline for d2erjd1: