Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Cytokine receptor common gamma chain [141041] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141042] (6 PDB entries) Uniprot P31785 142-246! Uniprot P31785 142-248! Uniprot P31785 54-141! Uniprot P31785 56-141 |
Domain d2erjc2: 2erj C:130-226 [132293] Other proteins in same PDB: d2erja1, d2erja2, d2erjb1, d2erjb2, d2erjb3, d2erjd_, d2erje1, d2erje2, d2erjf1, d2erjf2, d2erjf3, d2erjh_ complexed with nag |
PDB Entry: 2erj (more details), 3 Å
SCOPe Domain Sequences for d2erjc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2erjc2 b.1.2.1 (C:130-226) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} vipwapenltlhklsesqlelnwnnrflnhclehlvqyrtdwdhswteqsvdyrhkfslp svdgqkrytfrvrsrfnplcgsaqhwsewshpihwgs
Timeline for d2erjc2: