Lineage for d2erjc2 (2erj C:130-226)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1109778Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1109779Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1109810Protein Cytokine receptor common gamma chain [141041] (1 species)
  7. 1109811Species Human (Homo sapiens) [TaxId:9606] [141042] (3 PDB entries)
    Uniprot P31785 142-246! Uniprot P31785 142-248! Uniprot P31785 54-141! Uniprot P31785 56-141
  8. 1109817Domain d2erjc2: 2erj C:130-226 [132293]
    Other proteins in same PDB: d2erja1, d2erja2, d2erjb1, d2erjb2, d2erjd1, d2erje1, d2erje2, d2erjf1, d2erjf2, d2erjh1
    complexed with nag

Details for d2erjc2

PDB Entry: 2erj (more details), 3 Å

PDB Description: crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2
PDB Compounds: (C:) Cytokine receptor common gamma chain

SCOPe Domain Sequences for d2erjc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2erjc2 b.1.2.1 (C:130-226) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}
vipwapenltlhklsesqlelnwnnrflnhclehlvqyrtdwdhswteqsvdyrhkfslp
svdgqkrytfrvrsrfnplcgsaqhwsewshpihwgs

SCOPe Domain Coordinates for d2erjc2:

Click to download the PDB-style file with coordinates for d2erjc2.
(The format of our PDB-style files is described here.)

Timeline for d2erjc2: