Lineage for d2erjb2 (2erj B:6-103)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 787437Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 787438Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
    Pfam PF00041
  6. 787752Protein Interleukin-2 receptor beta chain [141047] (1 species)
  7. 787753Species Human (Homo sapiens) [TaxId:9606] [141048] (2 PDB entries)
    Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129
  8. 787757Domain d2erjb2: 2erj B:6-103 [132291]
    Other proteins in same PDB: d2erja1, d2erja2, d2erjc1, d2erjc2, d2erjd1, d2erje1, d2erje2, d2erjg1, d2erjg2, d2erjh1
    complexed with bma, fuc, nag; mutant

Details for d2erjb2

PDB Entry: 2erj (more details), 3 Å

PDB Description: crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2
PDB Compounds: (B:) Interleukin-2 receptor beta chain

SCOP Domain Sequences for d2erjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2erjb2 b.1.2.1 (B:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
sqftcfynsraniscvwsqdgalqdtscqvhawpdrrrwnqtcellpvsqaswacnlilg
apdsqklttvdivtlrvlcregvrwrvmaiqdfkpfen

SCOP Domain Coordinates for d2erjb2:

Click to download the PDB-style file with coordinates for d2erjb2.
(The format of our PDB-style files is described here.)

Timeline for d2erjb2: