Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Interleukin-2 receptor beta chain [141047] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141048] (3 PDB entries) Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129 |
Domain d2erjb1: 2erj B:104-206 [132290] Other proteins in same PDB: d2erja1, d2erja2, d2erjc1, d2erjc2, d2erjd1, d2erje1, d2erje2, d2erjg1, d2erjg2, d2erjh1 complexed with nag |
PDB Entry: 2erj (more details), 3 Å
SCOPe Domain Sequences for d2erjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2erjb1 b.1.2.1 (B:104-206) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} lrlmapislqvvhvethrcnisweisqashyferhlefeartlspghtweeaplltlkqk qewicletltpdtqyefqvrvkplqgefttwspwsqplafrtk
Timeline for d2erjb1: