Lineage for d2erfa_ (2erf A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779532Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 2779604Protein Thrombospondin 1 N-terminal domain [141150] (1 species)
  7. 2779605Species Human (Homo sapiens) [TaxId:9606] [141151] (6 PDB entries)
    Uniprot P07996 28-233! Uniprot P07996 29-233
  8. 2779606Domain d2erfa_: 2erf A: [132287]
    automated match to d1z78a1

Details for d2erfa_

PDB Entry: 2erf (more details), 1.45 Å

PDB Description: Crystal Structure of the Thrombospondin-1 N-terminal Domain at 1.45A Resolution
PDB Compounds: (A:) Thrombospondin-1

SCOPe Domain Sequences for d2erfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2erfa_ b.29.1.4 (A:) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ggdnsvfdifeltgaarkgsgrrlvkgpdpsspafriedanlippvpddkfqdlvdavrt
ekgflllaslrqmkktrgtllalerkdhsgqvfsvvsngkagtldlsltvqgkqhvvsve
eallatgqwksitlfvqedraqlyidcekmenaeldvpiqsvftrdlasiarlriakggv
ndnfqgvlqnvrfvfgttpedilrnkgcs

SCOPe Domain Coordinates for d2erfa_:

Click to download the PDB-style file with coordinates for d2erfa_.
(The format of our PDB-style files is described here.)

Timeline for d2erfa_: