SCOP 1.75: Domain d2eqba1: 2eqb A:19-186

Lineage for d2eqba1 (2eqb A:19-186)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab-related protein Sec4 [52607] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52608] (5 PDB entries)

8. Domain d2eqba1: 2eqb A:19-186 [132286]
   Other proteins in same PDB: d2eqbb1, d2eqbc1
   automatically matched to 2OCY C:18-186
   complexed with po4

Details for d2eqba1

PDB Entry: 2eqb, 2.7 Å

PDB Description: Crystal structure of the Rab GTPase Sec4p, the Sec2p GEF domain, and phosphate complex

PDB Compounds: (A:) Ras-related protein SEC4

SCOP Domain Sequences for d2eqba1:

Sequence; same for both SEQRES and ATOM records:

>d2eqba1 c.37.1.8 (A:19-186) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
simkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqlwdtag
qerfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksdme
trvvtadqgealakelgipfiessaknddnvneifftlakliqekids

Timeline for d2eqba1:

• d2eqba1 first appeared in SCOP 1.73
  
• d2eqba1 is called d2eqba_ in SCOPe 2.01
  
• d2eqba1 appears in the current release, SCOPe 2.08, called d2eqba2