![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein automated matches [190047] (37 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187069] (9 PDB entries) |
![]() | Domain d2eqba2: 2eqb A:19-187 [132286] Other proteins in same PDB: d2eqba3, d2eqbb1, d2eqbb2, d2eqbc2, d2eqbc3 automated match to d1g16b_ complexed with po4 |
PDB Entry: 2eqb (more details), 2.7 Å
SCOPe Domain Sequences for d2eqba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eqba2 c.37.1.8 (A:19-187) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} simkilligdsgvgkscllvrfvedkfnpsfittigidfkiktvdingkkvklqlwdtag qerfrtittayyrgamgiilvydvtdertftnikqwfktvnehandeaqlllvgnksdme trvvtadqgealakelgipfiessaknddnvneifftlakliqekidsn
Timeline for d2eqba2:
![]() Domains from other chains: (mouse over for more information) d2eqbb1, d2eqbb2, d2eqbc2, d2eqbc3 |