Lineage for d2eked_ (2eke D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402285Protein SUMO-1 (smt3 homologue) [54241] (2 species)
  7. 1402286Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [54243] (3 PDB entries)
  8. 1402289Domain d2eked_: 2eke D: [132284]
    Other proteins in same PDB: d2ekea_, d2ekeb_
    automated match to d1a5ra_

Details for d2eked_

PDB Entry: 2eke (more details), 1.9 Å

PDB Description: Structure of a SUMO-binding-motif mimic bound to Smt3p-Ubc9p: conservation of a noncovalent Ubiquitin-like protein-E2 complex as a platform for selective interactions within a SUMO pathway
PDB Compounds: (D:) Ubiquitin-like protein SMT3

SCOPe Domain Sequences for d2eked_:

Sequence, based on SEQRES records: (download)

>d2eked_ d.15.1.1 (D:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}
dplvprgsevkpevkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslr
flydgiriqadqtpedldmedndiieahre

Sequence, based on observed residues (ATOM records): (download)

>d2eked_ d.15.1.1 (D:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}
dplvprgsevkpkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrfl
ydgiriqadqtpedldmedndiieahre

SCOPe Domain Coordinates for d2eked_:

Click to download the PDB-style file with coordinates for d2eked_.
(The format of our PDB-style files is described here.)

Timeline for d2eked_: