Lineage for d2eked1 (2eke D:1020-1094)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1194675Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1194676Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1194772Protein SUMO-1 (smt3 homologue) [54241] (2 species)
  7. 1194773Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [54243] (3 PDB entries)
  8. 1194776Domain d2eked1: 2eke D:1020-1094 [132284]
    Other proteins in same PDB: d2ekea_, d2ekeb_
    automatically matched to d1euvb_

Details for d2eked1

PDB Entry: 2eke (more details), 1.9 Å

PDB Description: Structure of a SUMO-binding-motif mimic bound to Smt3p-Ubc9p: conservation of a noncovalent Ubiquitin-like protein-E2 complex as a platform for selective interactions within a SUMO pathway
PDB Compounds: (D:) Ubiquitin-like protein SMT3

SCOPe Domain Sequences for d2eked1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eked1 d.15.1.1 (D:1020-1094) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}
pethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpe
dldmedndiieahre

SCOPe Domain Coordinates for d2eked1:

Click to download the PDB-style file with coordinates for d2eked1.
(The format of our PDB-style files is described here.)

Timeline for d2eked1: