![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein SUMO-1 (smt3 homologue) [54241] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [54243] (3 PDB entries) |
![]() | Domain d2ekec_: 2eke C: [132283] Other proteins in same PDB: d2ekea_, d2ekeb_ automated match to d1a5ra_ |
PDB Entry: 2eke (more details), 1.9 Å
SCOPe Domain Sequences for d2ekec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ekec_ d.15.1.1 (C:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} dplvprgsevkpevkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslr flydgiriqadqtpedldmedndiieahreq
Timeline for d2ekec_: