Lineage for d2ekec_ (2eke C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1637453Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1637605Protein SUMO-1 (smt3 homologue) [54241] (3 species)
  7. 1637606Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [54243] (3 PDB entries)
  8. 1637608Domain d2ekec_: 2eke C: [132283]
    Other proteins in same PDB: d2ekea_, d2ekeb_
    automated match to d1a5ra_

Details for d2ekec_

PDB Entry: 2eke (more details), 1.9 Å

PDB Description: Structure of a SUMO-binding-motif mimic bound to Smt3p-Ubc9p: conservation of a noncovalent Ubiquitin-like protein-E2 complex as a platform for selective interactions within a SUMO pathway
PDB Compounds: (C:) Ubiquitin-like protein SMT3

SCOPe Domain Sequences for d2ekec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ekec_ d.15.1.1 (C:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}
dplvprgsevkpevkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslr
flydgiriqadqtpedldmedndiieahreq

SCOPe Domain Coordinates for d2ekec_:

Click to download the PDB-style file with coordinates for d2ekec_.
(The format of our PDB-style files is described here.)

Timeline for d2ekec_: