SCOPe 2.08: Domain d2ejnb1: 2ejn B:0-72

Lineage for d2ejnb1 (2ejn B:0-72)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.101: Uteroglobin-like [48200] (1 superfamily)
   multihelical

4. Superfamily a.101.1: Uteroglobin-like [48201] (2 families)
   disulfide-linked dimer of two identical chains, 4 helices in each

5. Family a.101.1.1: Uteroglobin-like [48202] (4 proteins)

6. Protein Allergen Fel d I-A chain [101359] (1 species)
   forms heterodimer with Fel d I-B chain

7. Species Cat (Felis catus) [TaxId:9685] [101360] (3 PDB entries)

8. Domain d2ejnb1: 2ejn B:0-72 [132281]
   Other proteins in same PDB: d2ejna2, d2ejnb2
   automated match to d1puoa1
   complexed with ca

Details for d2ejnb1

PDB Entry: 2ejn, 1.64 Å

PDB Description: structural characterization of the tetrameric form of the major cat allergen fel d 1

PDB Compounds: (B:) Major allergen I polypeptide chain 1, chain 2

SCOPe Domain Sequences for d2ejnb1:

Sequence; same for both SEQRES and ATOM records:

>d2ejnb1 a.101.1.1 (B:0-72) Allergen Fel d I-A chain {Cat (Felis catus) [TaxId: 9685]}
meicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteedkenals
lldkiytsplcvk

Timeline for d2ejnb1:

• d2ejnb1 first appeared in SCOP 1.73
  
• d2ejnb1 appears in SCOPe 2.07