SCOPe 2.07: Domain d2ejna2: 2ejn A:73-145

Lineage for d2ejna2 (2ejn A:73-145)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.101: Uteroglobin-like [48200] (1 superfamily)
   multihelical

4. Superfamily a.101.1: Uteroglobin-like [48201] (2 families)
   disulfide-linked dimer of two identical chains, 4 helices in each

5. Family a.101.1.1: Uteroglobin-like [48202] (4 proteins)

6. Protein Allergen Fel d I-B chain [101361] (1 species)
   forms heterodimer with Fel d I-A chain

7. Species Cat (Felis catus) [TaxId:9685] [101362] (3 PDB entries)

8. Domain d2ejna2: 2ejn A:73-145 [132280]
   Other proteins in same PDB: d2ejna1, d2ejnb1
   automated match to d1puoa2
   complexed with ca

Details for d2ejna2

PDB Entry: 2ejn, 1.64 Å

PDB Description: structural characterization of the tetrameric form of the major cat allergen fel d 1

PDB Compounds: (A:) Major allergen I polypeptide chain 1, chain 2

SCOPe Domain Sequences for d2ejna2:

Sequence; same for both SEQRES and ATOM records:

>d2ejna2 a.101.1.1 (A:73-145) Allergen Fel d I-B chain {Cat (Felis catus) [TaxId: 9685]}
maetcpifydvffavangnellldlsltkvnatepertamkkiqdcyvenglisrvldgl
vmttissskdcmg

Timeline for d2ejna2:

• d2ejna2 first appeared in SCOP 1.73
  
• d2ejna2 appears in SCOPe 2.06
  
• d2ejna2 appears in the current release, SCOPe 2.08