![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (40 superfamilies) not a true fold |
![]() | Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) ![]() automatically mapped to Pfam PF02046 |
![]() | Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species) probably responsible for the dimerization of the mitochondrial cytochrome c oxidase |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81408] (26 PDB entries) |
![]() | Domain d2eint_: 2ein T: [132272] Other proteins in same PDB: d2eina_, d2einb1, d2einb2, d2einc_, d2eind_, d2eine_, d2einf_, d2einh_, d2eini_, d2einj_, d2eink_, d2einl_, d2einm_, d2einn_, d2eino1, d2eino2, d2einp_, d2einq_, d2einr_, d2eins_, d2einu_, d2einv_, d2einw_, d2einx_, d2einy_, d2einz_ automated match to d1occg_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2ein (more details), 2.7 Å
SCOPe Domain Sequences for d2eint_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eint_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]} asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf swgdgnhtffhnprvnplptgyek
Timeline for d2eint_:
![]() Domains from other chains: (mouse over for more information) d2eina_, d2einb1, d2einb2, d2einc_, d2eind_, d2eine_, d2einf_, d2eing_, d2einh_, d2eini_, d2einj_, d2eink_, d2einl_, d2einm_, d2einn_, d2eino1, d2eino2, d2einp_, d2einq_, d2einr_, d2eins_, d2einu_, d2einv_, d2einw_, d2einx_, d2einy_, d2einz_ |