Lineage for d2eint_ (2ein T:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1697710Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
    automatically mapped to Pfam PF02046
  5. 1697711Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 1697712Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 1697713Species Cow (Bos taurus) [TaxId:9913] [81408] (25 PDB entries)
  8. 1697757Domain d2eint_: 2ein T: [132272]
    Other proteins in same PDB: d2eina_, d2einb1, d2einb2, d2einc_, d2eind_, d2eine_, d2einf_, d2einh_, d2eini_, d2einj_, d2eink_, d2einl_, d2einm_, d2einn_, d2eino1, d2eino2, d2einp_, d2einq_, d2einr_, d2eins_, d2einu_, d2einv_, d2einw_, d2einx_, d2einy_, d2einz_
    automated match to d1occg_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eint_

PDB Entry: 2ein (more details), 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (T:) Cytochrome c oxidase polypeptide VIa-heart

SCOPe Domain Sequences for d2eint_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eint_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d2eint_:

Click to download the PDB-style file with coordinates for d2eint_.
(The format of our PDB-style files is described here.)

Timeline for d2eint_: