Lineage for d2einf1 (2ein F:1-98)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 750855Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 750979Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
    membrane-anchored rubredoxin-like domain
  6. 750980Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 750981Species Cow (Bos taurus) [TaxId:9913] [57820] (14 PDB entries)
  8. 751004Domain d2einf1: 2ein F:1-98 [132257]
    Other proteins in same PDB: d2eina1, d2einb1, d2einb2, d2einc1, d2eind1, d2eine1, d2eing1, d2einh1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2einn1, d2eino1, d2eino2, d2einp1, d2einq1, d2einr1, d2eint1, d2einu1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1
    automatically matched to d1occf_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2einf1

PDB Entry: 2ein (more details), 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (F:) Cytochrome c oxidase polypeptide Vb

SCOP Domain Sequences for d2einf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2einf1 g.41.5.3 (F:1-98) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOP Domain Coordinates for d2einf1:

Click to download the PDB-style file with coordinates for d2einf1.
(The format of our PDB-style files is described here.)

Timeline for d2einf1: