SCOP 1.73: Domain d2einb2: 2ein B:1-90

Lineage for d2einb2 (2ein B:1-90)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (3 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (14 PDB entries)

8. Domain d2einb2: 2ein B:1-90 [132253]
   Other proteins in same PDB: d2eina1, d2einb1, d2einc1, d2eind1, d2eine1, d2einf1, d2eing1, d2einh1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2einn1, d2eino1, d2einp1, d2einq1, d2einr1, d2eins1, d2eint1, d2einu1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1
   automatically matched to d1occb2
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2einb2

PDB Entry: 2ein, 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d2einb2:

Sequence; same for both SEQRES and ATOM records:

>d2einb2 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d2einb2:

• d2einb2 is new in SCOP 1.73
  
• d2einb2 appears in SCOP 1.75
  
• d2einb2 appears in the current release, SCOPe 2.08