Lineage for d2eime1 (2eim E:5-109)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647493Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 647494Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 647495Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 647496Species Cow (Bos taurus) [TaxId:9913] [48482] (14 PDB entries)
  8. 647515Domain d2eime1: 2eim E:5-109 [132228]
    Other proteins in same PDB: d2eima1, d2eimb1, d2eimb2, d2eimc1, d2eimd1, d2eimf1, d2eimg1, d2eimh1, d2eimi1, d2eimj1, d2eimk1, d2eiml1, d2eimm1, d2eimn1, d2eimo1, d2eimo2, d2eimp1, d2eimq1, d2eims1, d2eimt1, d2eimu1, d2eimv1, d2eimw1, d2eimx1, d2eimy1, d2eimz1
    automatically matched to d1occe_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eime1

PDB Entry: 2eim (more details), 2.6 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (E:) Cytochrome c oxidase polypeptide Va

SCOP Domain Sequences for d2eime1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eime1 a.118.11.1 (E:5-109) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d2eime1:

Click to download the PDB-style file with coordinates for d2eime1.
(The format of our PDB-style files is described here.)

Timeline for d2eime1: