| Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
| Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) ![]() |
| Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
| Protein automated matches [190134] (3 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [187061] (18 PDB entries) |
| Domain d2eima_: 2eim A: [132223] Other proteins in same PDB: d2eimb1, d2eimb2, d2eimc_, d2eimd_, d2eime_, d2eimf_, d2eimg_, d2eimh_, d2eimi_, d2eimj_, d2eimk_, d2eiml_, d2eimm_, d2eimo1, d2eimo2, d2eimp_, d2eimq_, d2eimr_, d2eims_, d2eimt_, d2eimu_, d2eimv_, d2eimw_, d2eimx_, d2eimy_, d2eimz_ automated match to d1occa_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eim (more details), 2.6 Å
SCOPe Domain Sequences for d2eima_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eima_ f.24.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk
Timeline for d2eima_:
View in 3DDomains from other chains: (mouse over for more information) d2eimb1, d2eimb2, d2eimc_, d2eimd_, d2eime_, d2eimf_, d2eimg_, d2eimh_, d2eimi_, d2eimj_, d2eimk_, d2eiml_, d2eimm_, d2eimn_, d2eimo1, d2eimo2, d2eimp_, d2eimq_, d2eimr_, d2eims_, d2eimt_, d2eimu_, d2eimv_, d2eimw_, d2eimx_, d2eimy_, d2eimz_ |