Lineage for d2eima1 (2eim A:1-514)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887788Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 887789Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 887790Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (4 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 887812Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)
  7. 887813Species Cow (Bos taurus) [TaxId:9913] [81432] (14 PDB entries)
  8. 887832Domain d2eima1: 2eim A:1-514 [132223]
    Other proteins in same PDB: d2eimb1, d2eimb2, d2eimc1, d2eimd1, d2eime1, d2eimf1, d2eimg1, d2eimh1, d2eimi1, d2eimj1, d2eimk1, d2eiml1, d2eimm1, d2eimo1, d2eimo2, d2eimp1, d2eimq1, d2eimr1, d2eims1, d2eimt1, d2eimu1, d2eimv1, d2eimw1, d2eimx1, d2eimy1, d2eimz1
    automatically matched to d1occa_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eima1

PDB Entry: 2eim (more details), 2.6 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOP Domain Sequences for d2eima1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eima1 f.24.1.1 (A:1-514) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

SCOP Domain Coordinates for d2eima1:

Click to download the PDB-style file with coordinates for d2eima1.
(The format of our PDB-style files is described here.)

Timeline for d2eima1: