Lineage for d2eilw_ (2eil W:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025133Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
    automatically mapped to Pfam PF02238
  5. 3025134Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 proteins)
  6. 3025135Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 3025136Species Cow (Bos taurus) [TaxId:9913] [81416] (56 PDB entries)
  8. 3025164Domain d2eilw_: 2eil W: [132219]
    Other proteins in same PDB: d2eila_, d2eilb1, d2eilb2, d2eilc_, d2eild_, d2eile_, d2eilf_, d2eilg_, d2eilh_, d2eili_, d2eilk_, d2eill_, d2eilm_, d2eiln_, d2eilo1, d2eilo2, d2eilp_, d2eilq_, d2eilr_, d2eils_, d2eilt_, d2eilu_, d2eilv_, d2eilx_, d2eily_, d2eilz_
    automated match to d1ocrj_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eilw_

PDB Entry: 2eil (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (W:) Cytochrome c oxidase polypeptide VIIa-heart

SCOPe Domain Sequences for d2eilw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eilw_ f.23.4.1 (W:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk

SCOPe Domain Coordinates for d2eilw_:

Click to download the PDB-style file with coordinates for d2eilw_.
(The format of our PDB-style files is described here.)

Timeline for d2eilw_: