Lineage for d2eilq1 (2eil Q:4-147)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745534Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
  5. 745535Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (1 protein)
  6. 745536Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 745537Species Cow (Bos taurus) [TaxId:9913] [81403] (14 PDB entries)
  8. 745547Domain d2eilq1: 2eil Q:4-147 [132213]
    Other proteins in same PDB: d2eila1, d2eilb1, d2eilb2, d2eilc1, d2eile1, d2eilf1, d2eilg1, d2eilh1, d2eili1, d2eilj1, d2eilk1, d2eill1, d2eilm1, d2eiln1, d2eilo1, d2eilo2, d2eilp1, d2eilr1, d2eils1, d2eilt1, d2eilu1, d2eilv1, d2eilw1, d2eilx1, d2eily1, d2eilz1
    automatically matched to d1occd_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eilq1

PDB Entry: 2eil (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (Q:) Cytochrome c oxidase subunit 4 isoform 1

SCOP Domain Sequences for d2eilq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eilq1 f.23.1.1 (Q:4-147) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOP Domain Coordinates for d2eilq1:

Click to download the PDB-style file with coordinates for d2eilq1.
(The format of our PDB-style files is described here.)

Timeline for d2eilq1: