Lineage for d2eila_ (2eil A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632295Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 2632296Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 2632297Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 2632417Protein automated matches [190134] (4 species)
    not a true protein
  7. 2632418Species Cow (Bos taurus) [TaxId:9913] [187061] (18 PDB entries)
  8. 2632435Domain d2eila_: 2eil A: [132195]
    Other proteins in same PDB: d2eilb1, d2eilb2, d2eilc_, d2eild_, d2eile_, d2eilf_, d2eilg_, d2eilh_, d2eili_, d2eilj_, d2eilk_, d2eill_, d2eilm_, d2eilo1, d2eilo2, d2eilp_, d2eilq_, d2eilr_, d2eils_, d2eilt_, d2eilu_, d2eilv_, d2eilw_, d2eilx_, d2eily_, d2eilz_
    automated match to d1occa_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eila_

PDB Entry: 2eil (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d2eila_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eila_ f.24.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

SCOPe Domain Coordinates for d2eila_:

Click to download the PDB-style file with coordinates for d2eila_.
(The format of our PDB-style files is described here.)

Timeline for d2eila_: