SCOPe 2.07: Domain d2eikz_: 2eik Z:

Lineage for d2eikz_ (2eik Z:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family)
   automatically mapped to Pfam PF02285

5. Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)

6. Protein automated matches [190273] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187065] (25 PDB entries)

8. Domain d2eikz_: 2eik Z: [132194]
   Other proteins in same PDB: d2eika_, d2eikb1, d2eikb2, d2eikc_, d2eikd_, d2eike_, d2eikf_, d2eikg_, d2eikh_, d2eiki_, d2eikj_, d2eikk_, d2eikl_, d2eikn_, d2eiko1, d2eiko2, d2eikp_, d2eikq_, d2eikr_, d2eiks_, d2eikt_, d2eiku_, d2eikv_, d2eikw_, d2eikx_, d2eiky_
   automated match to d1occm_
   complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eikz_

PDB Entry: 2eik, 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state

PDB Compounds: (Z:) Cytochrome c oxidase polypeptide VIII-heart

SCOPe Domain Sequences for d2eikz_:

Sequence; same for both SEQRES and ATOM records:

>d2eikz_ f.23.7.1 (Z:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

Timeline for d2eikz_:

• d2eikz_ first appeared in SCOP 1.73, called d2eikz1
  
• d2eikz_ appears in SCOPe 2.06
  
• d2eikz_ appears in the current release, SCOPe 2.08