Lineage for d2eikr_ (2eik R:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340249Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) (S)
    automatically mapped to Pfam PF02284
  5. 2340250Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2340251Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 2340252Species Cow (Bos taurus) [TaxId:9913] [48482] (49 PDB entries)
  8. 2340292Domain d2eikr_: 2eik R: [132186]
    Other proteins in same PDB: d2eika_, d2eikb1, d2eikb2, d2eikc_, d2eikd_, d2eikf_, d2eikg_, d2eikh_, d2eiki_, d2eikj_, d2eikk_, d2eikl_, d2eikm_, d2eikn_, d2eiko1, d2eiko2, d2eikp_, d2eikq_, d2eiks_, d2eikt_, d2eiku_, d2eikv_, d2eikw_, d2eikx_, d2eiky_, d2eikz_
    automated match to d1occe_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eikr_

PDB Entry: 2eik (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (R:) Cytochrome c oxidase polypeptide Va

SCOPe Domain Sequences for d2eikr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eikr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d2eikr_:

Click to download the PDB-style file with coordinates for d2eikr_.
(The format of our PDB-style files is described here.)

Timeline for d2eikr_: