![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) ![]() automatically mapped to Pfam PF02936 |
![]() | Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins) |
![]() | Protein automated matches [190270] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187062] (19 PDB entries) |
![]() | Domain d2eikq_: 2eik Q: [132185] Other proteins in same PDB: d2eika_, d2eikb1, d2eikb2, d2eikc_, d2eike_, d2eikf_, d2eikg_, d2eikh_, d2eiki_, d2eikj_, d2eikk_, d2eikl_, d2eikm_, d2eikn_, d2eiko1, d2eiko2, d2eikp_, d2eikr_, d2eiks_, d2eikt_, d2eiku_, d2eikv_, d2eikw_, d2eikx_, d2eiky_, d2eikz_ automated match to d1occd_ complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eik (more details), 2.1 Å
SCOPe Domain Sequences for d2eikq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eikq_ f.23.1.1 (Q:) automated matches {Cow (Bos taurus) [TaxId: 9913]} svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm ldmkvapiqgfsakwdydknewkk
Timeline for d2eikq_:
![]() Domains from other chains: (mouse over for more information) d2eika_, d2eikb1, d2eikb2, d2eikc_, d2eikd_, d2eike_, d2eikf_, d2eikg_, d2eikh_, d2eiki_, d2eikj_, d2eikk_, d2eikl_, d2eikm_, d2eikn_, d2eiko1, d2eiko2, d2eikp_, d2eikr_, d2eiks_, d2eikt_, d2eiku_, d2eikv_, d2eikw_, d2eikx_, d2eiky_, d2eikz_ |