Class a: All alpha proteins [46456] (289 folds) |
Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) |
Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
Protein automated matches [190271] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187063] (25 PDB entries) |
Domain d2eikh_: 2eik H: [132175] Other proteins in same PDB: d2eika_, d2eikb1, d2eikb2, d2eikc_, d2eikd_, d2eike_, d2eikf_, d2eikg_, d2eiki_, d2eikj_, d2eikk_, d2eikl_, d2eikm_, d2eikn_, d2eiko1, d2eiko2, d2eikp_, d2eikq_, d2eikr_, d2eiks_, d2eikt_, d2eikv_, d2eikw_, d2eikx_, d2eiky_, d2eikz_ automated match to d1ocrh_ complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eik (more details), 2.1 Å
SCOPe Domain Sequences for d2eikh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eikh_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]} kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi swvstwddrraegtfpgki
Timeline for d2eikh_:
View in 3D Domains from other chains: (mouse over for more information) d2eika_, d2eikb1, d2eikb2, d2eikc_, d2eikd_, d2eike_, d2eikf_, d2eikg_, d2eiki_, d2eikj_, d2eikk_, d2eikl_, d2eikm_, d2eikn_, d2eiko1, d2eiko2, d2eikp_, d2eikq_, d2eikr_, d2eiks_, d2eikt_, d2eiku_, d2eikv_, d2eikw_, d2eikx_, d2eiky_, d2eikz_ |