Lineage for d2eikb2 (2eik B:1-90)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629435Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2629436Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 2629488Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 2629489Species Cow (Bos taurus) [TaxId:9913] [81454] (45 PDB entries)
  8. 2629526Domain d2eikb2: 2eik B:1-90 [132169]
    Other proteins in same PDB: d2eika_, d2eikb1, d2eikc_, d2eikd_, d2eike_, d2eikf_, d2eikg_, d2eikh_, d2eiki_, d2eikj_, d2eikk_, d2eikl_, d2eikm_, d2eikn_, d2eiko1, d2eikp_, d2eikq_, d2eikr_, d2eiks_, d2eikt_, d2eiku_, d2eikv_, d2eikw_, d2eikx_, d2eiky_, d2eikz_
    automated match to d1v54b2
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eikb2

PDB Entry: 2eik (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2eikb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eikb2 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d2eikb2:

Click to download the PDB-style file with coordinates for d2eikb2.
(The format of our PDB-style files is described here.)

Timeline for d2eikb2: