![]() | Class g: Small proteins [56992] (92 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
![]() | Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins) membrane-anchored rubredoxin-like domain automatically mapped to Pfam PF01215 |
![]() | Protein Cytochrome c oxidase Subunit F [57819] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [57820] (26 PDB entries) |
![]() | Domain d2eijs_: 2eij S: [132159] Other proteins in same PDB: d2eija_, d2eijb1, d2eijb2, d2eijc_, d2eijd_, d2eije_, d2eijg_, d2eijh_, d2eiji_, d2eijj_, d2eijk_, d2eijl_, d2eijm_, d2eijn_, d2eijo1, d2eijo2, d2eijp_, d2eijq_, d2eijr_, d2eijt_, d2eiju_, d2eijv_, d2eijw_, d2eijx_, d2eijy_, d2eijz_ automated match to d1occf_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eij (more details), 1.9 Å
SCOPe Domain Sequences for d2eijs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eijs_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]} asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc iceednstviwfwlhkgeaqrcpscgthyklvphqlah
Timeline for d2eijs_:
![]() Domains from other chains: (mouse over for more information) d2eija_, d2eijb1, d2eijb2, d2eijc_, d2eijd_, d2eije_, d2eijf_, d2eijg_, d2eijh_, d2eiji_, d2eijj_, d2eijk_, d2eijl_, d2eijm_, d2eijn_, d2eijo1, d2eijo2, d2eijp_, d2eijq_, d2eijr_, d2eijt_, d2eiju_, d2eijv_, d2eijw_, d2eijx_, d2eijy_, d2eijz_ |