Lineage for d2eijr1 (2eij R:5-109)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647493Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 647494Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 647495Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 647496Species Cow (Bos taurus) [TaxId:9913] [48482] (14 PDB entries)
  8. 647504Domain d2eijr1: 2eij R:5-109 [132158]
    Other proteins in same PDB: d2eija1, d2eijb1, d2eijb2, d2eijc1, d2eijd1, d2eijf1, d2eijg1, d2eijh1, d2eiji1, d2eijj1, d2eijk1, d2eijl1, d2eijm1, d2eijn1, d2eijo1, d2eijo2, d2eijp1, d2eijq1, d2eijs1, d2eijt1, d2eiju1, d2eijv1, d2eijw1, d2eijx1, d2eijy1, d2eijz1
    automatically matched to d1occe_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eijr1

PDB Entry: 2eij (more details), 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (R:) Cytochrome c oxidase polypeptide Va

SCOP Domain Sequences for d2eijr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eijr1 a.118.11.1 (R:5-109) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d2eijr1:

Click to download the PDB-style file with coordinates for d2eijr1.
(The format of our PDB-style files is described here.)

Timeline for d2eijr1: