SCOP 1.73: Domain d2eiji1: 2eij I:1-73

Lineage for d2eiji1 (2eij I:1-73)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family)

5. Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81412] (14 PDB entries)

8. Domain d2eiji1: 2eij I:1-73 [132148]
   Other proteins in same PDB: d2eija1, d2eijb1, d2eijb2, d2eijc1, d2eijd1, d2eije1, d2eijf1, d2eijg1, d2eijh1, d2eijj1, d2eijk1, d2eijl1, d2eijm1, d2eijn1, d2eijo1, d2eijo2, d2eijp1, d2eijq1, d2eijr1, d2eijs1, d2eijt1, d2eiju1, d2eijw1, d2eijx1, d2eijy1, d2eijz1
   automatically matched to d1occi_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eiji1

PDB Entry: 2eij, 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state

PDB Compounds: (I:) Cytochrome c oxidase polypeptide VIc

SCOP Domain Sequences for d2eiji1:

Sequence; same for both SEQRES and ATOM records:

>d2eiji1 f.23.3.1 (I:1-73) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

Timeline for d2eiji1:

• d2eiji1 is new in SCOP 1.73
  
• d2eiji1 appears in SCOP 1.75
  
• d2eiji1 appears in the current release, SCOPe 2.08, called d2eiji_