SCOPe 2.06: Domain d2eiea3: 2eie A:151-537

Lineage for d2eiea3 (2eie A:151-537)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families)

5. Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins)

6. Protein Galactose oxidase, central domain [50967] (3 species)
   N-terminal domain is a jelly-roll sandwich
   C-terminal domain is Immunoglobulin-like

7. Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [159255] (6 PDB entries)

8. Domain d2eiea3: 2eie A:151-537 [132138]
   Other proteins in same PDB: d2eiea1, d2eiea2
   automated match to d1gofa3
   complexed with azi, cu

Details for d2eiea3

PDB Entry: 2eie, 1.8 Å

PDB Description: Crystal Structure of Galactose Oxidase complexed with Azide

PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2eiea3:

Sequence; same for both SEQRES and ATOM records:

>d2eiea3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

Timeline for d2eiea3:

• d2eiea3 first appeared in SCOP 1.73
  
• d2eiea3 appears in SCOPe 2.05
  
• d2eiea3 appears in SCOPe 2.07
  
• d2eiea3 appears in the current release, SCOPe 2.08