![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) ![]() |
![]() | Family b.18.1.1: Galactose-binding domain [49786] (2 proteins) |
![]() | Protein Galactose oxidase, N-terminal domain [49787] (3 species) |
![]() | Species Fungus (Fusarium sp.) [TaxId:29916] [69209] (5 PDB entries) sequence identical to that of Dactylium dendroides |
![]() | Domain d2eiea2: 2eie A:1-150 [132137] Other proteins in same PDB: d2eiea1, d2eiea3 automatically matched to d1k3ia2 complexed with azi, cu |
PDB Entry: 2eie (more details), 1.8 Å
SCOPe Domain Sequences for d2eiea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eiea2 b.18.1.1 (A:1-150) Galactose oxidase, N-terminal domain {Fungus (Fusarium sp.) [TaxId: 29916]} asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp aryvrlvaiteangqpwtsiaeinvfqass
Timeline for d2eiea2: