SCOP 1.73: Domain d2eiea2: 2eie A:1-150

Lineage for d2eiea2 (2eie A:1-150)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families)

5. Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)

6. Protein Galactose oxidase, N-terminal domain [49787] (2 species)

7. Species Fungi (Fusarium sp.) [TaxId:29916] [69209] (5 PDB entries)
   sequence identical to that of Dactylium dendroides

8. Domain d2eiea2: 2eie A:1-150 [132137]
   Other proteins in same PDB: d2eiea1, d2eiea3
   automatically matched to d1k3ia2
   complexed with azi, cu

Details for d2eiea2

PDB Entry: 2eie, 1.8 Å

PDB Description: Crystal Structure of Galactose Oxidase complexed with Azide

PDB Compounds: (A:) Galactose oxidase

SCOP Domain Sequences for d2eiea2:

Sequence; same for both SEQRES and ATOM records:

>d2eiea2 b.18.1.1 (A:1-150) Galactose oxidase, N-terminal domain {Fungi (Fusarium sp.) [TaxId: 29916]}
asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
aryvrlvaiteangqpwtsiaeinvfqass

Timeline for d2eiea2:

• d2eiea2 is new in SCOP 1.73
  
• d2eiea2 appears in SCOP 1.75
  
• d2eiea2 appears in the current release, SCOPe 2.08