Lineage for d2eiea2 (2eie A:1-150)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774102Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
    automatically mapped to Pfam PF00754
  6. 2774103Protein Galactose oxidase, N-terminal domain [49787] (3 species)
  7. 2774111Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [158956] (6 PDB entries)
  8. 2774112Domain d2eiea2: 2eie A:1-150 [132137]
    Other proteins in same PDB: d2eiea1, d2eiea3
    automated match to d1gofa2
    complexed with azi, cu

Details for d2eiea2

PDB Entry: 2eie (more details), 1.8 Å

PDB Description: Crystal Structure of Galactose Oxidase complexed with Azide
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2eiea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eiea2 b.18.1.1 (A:1-150) Galactose oxidase, N-terminal domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
aryvrlvaiteangqpwtsiaeinvfqass

SCOPe Domain Coordinates for d2eiea2:

Click to download the PDB-style file with coordinates for d2eiea2.
(The format of our PDB-style files is described here.)

Timeline for d2eiea2: