Lineage for d2eiea1 (2eie A:538-639)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 937592Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 937712Protein Galactose oxidase, C-terminal domain [49209] (3 species)
    follows the catalytic seven-bladed beta-propeller domain
  7. 937713Species Dactylium dendroides [TaxId:5132] [49210] (8 PDB entries)
    Uniprot Q01745 42-680
  8. 937715Domain d2eiea1: 2eie A:538-639 [132136]
    Other proteins in same PDB: d2eiea2, d2eiea3
    automatically matched to d1gof_1
    complexed with azi, cu

Details for d2eiea1

PDB Entry: 2eie (more details), 1.8 Å

PDB Description: Crystal Structure of Galactose Oxidase complexed with Azide
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2eiea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eiea1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Dactylium dendroides [TaxId: 5132]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

SCOPe Domain Coordinates for d2eiea1:

Click to download the PDB-style file with coordinates for d2eiea1.
(The format of our PDB-style files is described here.)

Timeline for d2eiea1: