Lineage for d2eida3 (2eid A:151-537)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807549Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 807550Superfamily b.69.1: Galactose oxidase, central domain [50965] (1 family) (S)
  5. 807551Family b.69.1.1: Galactose oxidase, central domain [50966] (1 protein)
  6. 807552Protein Galactose oxidase, central domain [50967] (3 species)
    N-terminal domain is a jelly-roll sandwich
    C-terminal domain is Immunoglobulin-like
  7. 807553Species Dactylium dendroides [TaxId:5132] [50968] (8 PDB entries)
    Uniprot Q01745 42-680
  8. 807557Domain d2eida3: 2eid A:151-537 [132135]
    Other proteins in same PDB: d2eida1, d2eida2
    automatically matched to d1gof_3
    complexed with cu, na; mutant

Details for d2eida3

PDB Entry: 2eid (more details), 2.2 Å

PDB Description: galactose oxidase w290g mutant
PDB Compounds: (A:) Galactose oxidase

SCOP Domain Sequences for d2eida3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eida3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Dactylium dendroides [TaxId: 5132]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggsgsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

SCOP Domain Coordinates for d2eida3:

Click to download the PDB-style file with coordinates for d2eida3.
(The format of our PDB-style files is described here.)

Timeline for d2eida3: