Lineage for d2eida2 (2eid A:1-150)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 942101Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 942102Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 942103Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
  6. 942104Protein Galactose oxidase, N-terminal domain [49787] (3 species)
  7. 942110Species Fungus (Fusarium sp.) [TaxId:29916] [69209] (5 PDB entries)
    sequence identical to that of Dactylium dendroides
  8. 942114Domain d2eida2: 2eid A:1-150 [132134]
    Other proteins in same PDB: d2eida1, d2eida3
    automatically matched to d1k3ia2
    complexed with cu, na; mutant

Details for d2eida2

PDB Entry: 2eid (more details), 2.2 Å

PDB Description: galactose oxidase w290g mutant
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2eida2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eida2 b.18.1.1 (A:1-150) Galactose oxidase, N-terminal domain {Fungus (Fusarium sp.) [TaxId: 29916]}
asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
aryvrlvaiteangqpwtsiaeinvfqass

SCOPe Domain Coordinates for d2eida2:

Click to download the PDB-style file with coordinates for d2eida2.
(The format of our PDB-style files is described here.)

Timeline for d2eida2: