Lineage for d2eida1 (2eid A:538-639)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111574Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1111680Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 1111799Protein Galactose oxidase, C-terminal domain [49209] (3 species)
    follows the catalytic seven-bladed beta-propeller domain
  7. 1111807Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [158881] (7 PDB entries)
  8. 1111813Domain d2eida1: 2eid A:538-639 [132133]
    Other proteins in same PDB: d2eida2, d2eida3
    automatically matched to d1gof_1
    complexed with cu, na; mutant

Details for d2eida1

PDB Entry: 2eid (more details), 2.2 Å

PDB Description: galactose oxidase w290g mutant
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2eida1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eida1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

SCOPe Domain Coordinates for d2eida1:

Click to download the PDB-style file with coordinates for d2eida1.
(The format of our PDB-style files is described here.)

Timeline for d2eida1: