SCOP 1.75: Domain d2eida1: 2eid A:538-639

Lineage for d2eida1 (2eid A:538-639)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Galactose oxidase, C-terminal domain [49209] (3 species)
   follows the catalytic seven-bladed beta-propeller domain

7. Species Dactylium dendroides [TaxId:5132] [49210] (8 PDB entries)
   Uniprot Q01745 42-680

8. Domain d2eida1: 2eid A:538-639 [132133]
   Other proteins in same PDB: d2eida2, d2eida3
   automatically matched to d1gof_1
   complexed with cu, na; mutant

Details for d2eida1

PDB Entry: 2eid, 2.2 Å

PDB Description: galactose oxidase w290g mutant

PDB Compounds: (A:) Galactose oxidase

SCOP Domain Sequences for d2eida1:

Sequence; same for both SEQRES and ATOM records:

>d2eida1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Dactylium dendroides [TaxId: 5132]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

Timeline for d2eida1:

• d2eida1 first appeared in SCOP 1.73
  
• d2eida1 appears in SCOPe 2.01
  
• d2eida1 appears in the current release, SCOPe 2.08