SCOPe 2.04: Domain d2eica3: 2eic A:151-537

Lineage for d2eica3 (2eic A:151-537)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.1: Galactose oxidase, central domain [50965] (1 family)

5. Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins)

6. Protein Galactose oxidase, central domain [50967] (3 species)
   N-terminal domain is a jelly-roll sandwich
   C-terminal domain is Immunoglobulin-like

7. Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [159255] (6 PDB entries)

8. Domain d2eica3: 2eic A:151-537 [132132]
   Other proteins in same PDB: d2eica1, d2eica2
   automated match to d1gofa3
   complexed with cu1, na; mutant

Details for d2eica3

PDB Entry: 2eic, 2.8 Å

PDB Description: crystal structure of galactose oxidase mutant w290f

PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2eica3:

Sequence; same for both SEQRES and ATOM records:

>d2eica3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggsfsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

Timeline for d2eica3:

• d2eica3 first appeared in SCOP 1.73
  
• d2eica3 appears in SCOPe 2.03
  
• d2eica3 appears in SCOPe 2.05
  
• d2eica3 appears in the current release, SCOPe 2.08