Lineage for d2eica3 (2eic A:151-537)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808720Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families) (S)
  5. 2808721Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins)
  6. 2808722Protein Galactose oxidase, central domain [50967] (3 species)
    N-terminal domain is a jelly-roll sandwich
    C-terminal domain is Immunoglobulin-like
  7. 2808730Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [159255] (6 PDB entries)
  8. 2808736Domain d2eica3: 2eic A:151-537 [132132]
    Other proteins in same PDB: d2eica1, d2eica2
    automated match to d1gofa3
    complexed with cu1, na; mutant

Details for d2eica3

PDB Entry: 2eic (more details), 2.8 Å

PDB Description: crystal structure of galactose oxidase mutant w290f
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2eica3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eica3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggsfsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

SCOPe Domain Coordinates for d2eica3:

Click to download the PDB-style file with coordinates for d2eica3.
(The format of our PDB-style files is described here.)

Timeline for d2eica3: