Lineage for d2eica1 (2eic A:538-639)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658673Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 658790Protein Galactose oxidase, C-terminal domain [49209] (2 species)
    follows the catalytic seven-bladed beta-propeller domain
  7. 658791Species Dactylium dendroides [TaxId:5132] [49210] (8 PDB entries)
  8. 658799Domain d2eica1: 2eic A:538-639 [132130]
    Other proteins in same PDB: d2eica2, d2eica3
    automatically matched to d1gof_1
    complexed with cu1, na; mutant

Details for d2eica1

PDB Entry: 2eic (more details), 2.8 Å

PDB Description: Crystal Structure of Galactose Oxidase mutant W290F
PDB Compounds: (A:) Galactose oxidase

SCOP Domain Sequences for d2eica1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eica1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Dactylium dendroides [TaxId: 5132]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

SCOP Domain Coordinates for d2eica1:

Click to download the PDB-style file with coordinates for d2eica1.
(The format of our PDB-style files is described here.)

Timeline for d2eica1: