Lineage for d2eiba2 (2eib A:1-150)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2383787Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
    automatically mapped to Pfam PF00754
  6. 2383788Protein Galactose oxidase, N-terminal domain [49787] (3 species)
  7. 2383796Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [158956] (6 PDB entries)
  8. 2383801Domain d2eiba2: 2eib A:1-150 [132128]
    Other proteins in same PDB: d2eiba1, d2eiba3
    automated match to d1gofa2
    complexed with act, cu, na, so4; mutant

Details for d2eiba2

PDB Entry: 2eib (more details), 2.1 Å

PDB Description: crystal structure of galactose oxidase, w290h mutant
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2eiba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eiba2 b.18.1.1 (A:1-150) Galactose oxidase, N-terminal domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
aryvrlvaiteangqpwtsiaeinvfqass

SCOPe Domain Coordinates for d2eiba2:

Click to download the PDB-style file with coordinates for d2eiba2.
(The format of our PDB-style files is described here.)

Timeline for d2eiba2: