![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.1: Galactose-binding domain [49786] (2 proteins) automatically mapped to Pfam PF00754 |
![]() | Protein Galactose oxidase, N-terminal domain [49787] (3 species) |
![]() | Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [158956] (6 PDB entries) |
![]() | Domain d2eiba2: 2eib A:1-150 [132128] Other proteins in same PDB: d2eiba1, d2eiba3 automated match to d1gofa2 complexed with act, cu, na, so4; mutant |
PDB Entry: 2eib (more details), 2.1 Å
SCOPe Domain Sequences for d2eiba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eiba2 b.18.1.1 (A:1-150) Galactose oxidase, N-terminal domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]} asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp aryvrlvaiteangqpwtsiaeinvfqass
Timeline for d2eiba2: