SCOPe 2.08: Domain d2eiba1: 2eib A:538-639

Lineage for d2eiba1 (2eib A:538-639)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Galactose oxidase, C-terminal domain [49209] (3 species)
   follows the catalytic seven-bladed beta-propeller domain

7. Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [158881] (6 PDB entries)

8. Domain d2eiba1: 2eib A:538-639 [132127]
   Other proteins in same PDB: d2eiba2, d2eiba3
   automated match to d1gofa1
   complexed with act, cu, na, so4; mutant

Details for d2eiba1

PDB Entry: 2eib, 2.1 Å

PDB Description: crystal structure of galactose oxidase, w290h mutant

PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2eiba1:

Sequence; same for both SEQRES and ATOM records:

>d2eiba1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

Timeline for d2eiba1:

• d2eiba1 first appeared in SCOP 1.73
  
• d2eiba1 appears in SCOPe 2.07