SCOP 1.73: Domain d2egha1: 2egh A:301-399

Lineage for d2egha1 (2egh A:301-399)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.3: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69055] (1 family)

5. Family a.69.3.1: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69056] (1 protein)

6. Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69057] (2 species)

7. Species Escherichia coli [TaxId:562] [69058] (11 PDB entries)

8. Domain d2egha1: 2egh A:301-399 [132121]
   Other proteins in same PDB: d2egha2, d2egha3, d2eghb2, d2eghb3
   automatically matched to d1jvsa1
   complexed with fom, mg, ndp

Details for d2egha1

PDB Entry: 2egh, 2.2 Å

PDB Description: Crystal structure of 1-deoxy-D-xylulose 5-phosphate reductoisomerase complexed with a magnesium ion, NADPH and fosmidomycin

PDB Compounds: (A:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOP Domain Sequences for d2egha1:

Sequence; same for both SEQRES and ATOM records:

>d2egha1 a.69.3.1 (A:301-399) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Escherichia coli [TaxId: 562]}
lsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaalnl
svlekmdmrepqcvddvlsvdanarevarkevmrlassa

Timeline for d2egha1:

• d2egha1 is new in SCOP 1.73
  
• d2egha1 appears in SCOP 1.75
  
• d2egha1 appears in the current release, SCOPe 2.08